YOGA SUTRAS OF PATANJALI
SAMADHI PADA
Freedom is the first step
Freedom is in the beginning. It is not an end result of any endeavour
or effort or ego-trips in any form. It is the energy of seeing and understanding,
not seeking and undertaking. Enlightenment is not entanglement with any
pre-concept or predetermined postulate, "it is" - not "it
will be" or "should be".
Doing anything for freedom from the mind while using the mind is the very
denial of this freedom. To be able to comprehend this, is the supreme
confirmation of this freedom. To perceive this freedom directly by and
for oneself, all pursuits and paradoxes about freedom must come to an
end. Freedom exists in disembodied and non-mental intelligence and energy,
not in the intellect and ego.
1. Ataha yoganushasanam
Yoga (the subtle disciplining of the apparent self, and thus being connected
to the real self) is now i.e. in
the energy of the presence of life and not
in the past or in the future
which is the residence of the mind. Mind is the expression of life, but
not life's euphoria or ecstasy. Mind is the bondage and burden of life,
not its bliss and benediction.
2. Yogaschitta vrtti nirodhah
Occasional pauses in the circulation of the traits and tendencies of the
mind (gunas) leads to yoga - the
connection of the personal intellect with universal intelligence.
3. Tada drastuh swarupeavasthanam
Sight of these discontinuities is the vision of the divine or real self
i.e. being established in one's natural self.
4. Vrtti sarupyamitarata
All else is mind, the separative consciousness, and its forms and formulations.
5. Vrittayah panchatayyah klistaklistah
The five constituents of the mind are responsible for suffering and non-suffering.
6. Pramana viparyaya vikalpa nidra smritayah
These are :
1) evidence
2) beliefs
3) choices
4) inertness
5) memory
(The field of memory is the ground on which the other four constituents occur. Evidence is at the top since it causes no suffering because of its availability to direct derivations and deductions without giving scope to delusions or deceptions).
7. Pratyakshanumanagamah pramanani
Evidence is direct perception and deduction therefrom.
8. Viparyayo mithyajnanamatadrupaprathistham
Belief systems are disastrous delusions and dogmas since they are based
on false knowledge and what should be (fancies and fantasies).
9. Shabda jnananupati vastu shunyo vikalpah
Choices (psychological ones not technical ones) are substance-less activities
that occur in proportion to conventional, cultural and verbal inputs.
10. Abhava pratyayalambana vrttirnidra
Insufficient reliance on direct perception ensnares us in postulates and
paradoxes. This is the dimension of the mind that is dull and non-wakeful.
11. Anubhutavisayasampramosah smrtih
Memory does not allow what is experienced to escape. Natural memory does
not get obsessed, it is not inhibited, nor does it have any psychological
residues such as influences or involvement.
12. Abhyasavairagyabhyam tannirodhah
Vairagya is perseverance in detachment. Vairagya is the refusal to be
involved with attraction and aversion. This eventually leads to discontinuity
in the constant churning of thought and to occasional pauses in the circulation
of the traits and tendencies of the mind.
13. Tatra sthitau yatno'bhyasah
Thereby be established in a wholehearted and careful process (of detachment).
14. Sa tu dirghakala nairantaryasatkarasevito
dridhabhumih
This process of detachment is firmly grounded in a long, dedicated and
uninterrupted reverential attitude.
15. Dristanushravika visayavitrisnasya
vashikara sanjna vairagyam
Detachment (vairagya) comes through
having complete attention (vashikara
sanjna). This is a result of aloofness from sense objects (visaya
vitrishna) i.e. when sensory perceptions are not converted into
sensuality by classification as pleasant or unpleasant.
16. Tat param purusakhyatergunavaitrisnyam
The highest intelligence (purusha)
is then understood as a consequence of maintaining aloofness (vitrishna)
from the gunas (traits of the mind, chittavritti).
17. Vitarka vicharanandasmitanugamat
samprajnatah
Equanimity in consciousness emerges when rationalisation and contemplation
occur in an atmosphere of blissful uniqueness i.e. without conforming
and becoming.
18. Virampratyayabhyasapurvah samskarashesonyah
The process of perceiving discontinuity (in the churning of mind) precedes
the ending of all kinds of conditioning (samskara-shesa-anyah).
19. Bhavapratyayo videhaprakritilayanam
Direct perception of disembodied intelligence (chaitanya
or purusha) occurs with the dissolution of the traits and tendencies
of the mind (gunas or prakritti).
20. Shraddhaviryasmritisamadhiprajnapurvaka
itaresam
Before the dissolution of the gunas occurs (leading to the natural state),
the following merits are needed:
1) Trust or dedication
2) Energy or vigour
3) Memory or intellect
4) Choice-less perception or equanimity (samadhi
prajna).
21. Tivrasamveganamasannah
An intense urge (for the natural state) will now arise.
22. Mridu madhyadhimatratvattatopi visesah
The urge evolves from mild to medium to strong and to even more uniqueness
and excellence.
23. Ishvarapranidhanadva
Leading to the direct and immediate perception of the wholeness.
24. Kleshakarmavipakashayairhaparamristah
purusavishesa Isvarah
In wholeness, the divinity is the highest intelligence (purusha
vishesa), uncontaminated by suffering resulting from entanglement
with, or expectation of the fruits of actions. The fragmented activities
of the mind are suffering. The wholeness, the intelligence, is untouched
by mind.
25. Tatra niratishayam sarvajna bijam
In wholeness (i.e. in no-mind) is the seed of limitless, holistic perception
(purusha).
26. Purvesamapi guruh kalenanavacchedat
Holistic perception, free from time (mind), is the greatest teacher of
all.
27. Tasya vachakah pranavah
If at all this holistic perception of the cosmic consciousness (purusha
or chaitanya purna) can be given sound, it can only be OM (pranava).
28. Tajjapastadarthabhavanam
OM can be chanted and contemplated upon.
29. Tatah pratyakchetanadhigamopyantarayabhavascha
OM is the centring of consciousness that overcomes all obstacles (arising
out of centrifugal tendencies).
30. Vyadhistyanasamsayapramadalasyaaviratibhrantidarsanalabdhabhumikatvanavasthitatvanichittaviksepasteantarayah
The following are obstacles to holistic perception:
1) Ill health
2) Dullness or inertness
3) Doubt or apprehension
4) Disorderly activities
5) Laziness
6) Craving
7) Illusory or erroneous observation
8) Not to remain grounded in the silence of the mind, the dimension of
"no-thought" or "no-mind" (not thoughtlessness nor
mindlessness)
9) Instability
10) Tension and distraction
31. Duhkhadaurmanasyangamejayatvashvasaprashvasaviksepasahabhuva
The suffering that accompanies the separative consciousness (mind) is:
1) Pain
2) Depression
3) Body not in control, hysteria or going berserk
4) Breathing not in harmony.
32. (I) Tatpratisedharthamekatattvabhyasah
The antidote for obstacles to holistic perception (for freedom from mind)
is to persevere towards freedom without any diversion whatsoever.
33. (II) Maitrikarunamuditopeksanam
suhkhaduhkhapunyapunyavisayanam bhavanataschittaprasadanam
Holistic consciousness is actually a benevolence that involves:
1) Equanimity in matters of happiness-misery, pleasant-unpleasant, virtue-vice
2) Friendliness
3) Compassion
4) Joyfulness
5) Renunciation
34. (III) Prachchhardana vidharanabhyam
va pranasya
The regulation of breath also leads to stillness and thus to holistic
awareness.
35. (IV) Visayavati va pravrittirutpanna
manasah sthitinibandhani
Freedom from the state of mental bondage (which results in the natural
functioning of sensory organs) leads to the ending of the infatuation
of the mind with objects and obsessions.
36. (V) Vishoka va jyotismati
The ending of sorrow or inner illumination (insight) will also lead to
freedom from time (i.e. mind).
37. (VI) Vitaragavisayam va chittam
Detachment from material possessions is also holistic consciousness (chaitanya
chitta).
38. (VII) Svapnanidrajnanalambanam va
Understanding the true nature of sleeping and dreaming results in freedom
from fragmented consciousness.
39. (VIII) Yathabhimatadhyanadva
Any meditation in accordance with one's own understanding and intuition
would lead to the essential freedom. (There is no method of meditation).
40. Paramanuparamamahattvaantosya vasikarah
Meditation (which converts borrowed knowledge into one's own knowing)
brings about a mastery over everything from the highest to the lowest
phenomenon.
41. Ksinavritterabhijatasyaeva manergrahitirgrahanagrahyesu
tatsthatadanjanata samapattih
In an accomplished one, wherein traits and tendencies (gunas
and vrittis) are disappearing (ksina),
the cogniser and the object of cognition become one unitary movement due
to the purity of sensory perception that remains untouched by sensuality
(mind), just as a clear crystal
takes the colour of that on which it rests.
(A brief comment on the meaning of the word samapatti
which is often substituted by samadhi:
Samapattti = sama + apatti = equal/choice-less + aloofness. This means
equally aloof from all centrifugality. In other words complete absorption
in equanimity. The difference between choice-less awareness and choice-less
aloofness is that in choice-less awareness one is still available to the
exterior whereas "equally aloof" indicates total absorption
in the interior. So samapatti
can be substituted by samadhi.)
42. Tatra shabdarthajnanavikalpaih samkirna
savitarka sama pattih
Thereafter, the shallow and argumentative consciousness, arising out of
choices and flowing from words with their interpretation and associated
concepts and conclusions, is completely absorbed.
43. Smritiparishuddhau svarupashunyevarthamatranirbhasa
nirvitarka
The ending of all images about oneself (svarupashunyeva)
leads to deconditioning (smritiparishuddhau)
and the ending of argumentative consciousness resulting in subtle simulation
of reality (arthamatra-nirbhasa).
44. Etayaiva savichara nirvichara cha
suksmavisaya vyakhyata
Thus subtle matters of mind and "no-mind" are explained and
understood.
45. Sukshmavisayatvam chaaliingaparyavasanam
Understanding these subtle matters leads to the ending of all forms and
formulations of the mind (alinga).
46. Ta eva sabijah samadhih
Even in all this freedom, the seeds of mind may still be present.
47. Nirvichara-vaisharadyeadhyatma-prasadah
The excellence and perfection of "no-mind" (pure intelligence)
results in the benediction of knowing the 'otherness'(adhyatma).
48. Ritambhara tatra prajna
In "no-mind" is the wisdom of cosmic intelligence - the otherness
- ritam.
49. Shruta-anumana-prajnabhyam amanya-visaya
vishesa-arthatvat
This ritam has very special significance,
it is beyond intellectual matters or the knowledge that the mind acquires
through testimony and inference.
50. Taj-jah samskaro-anya-samskara-pratibandhi
Cosmic intelligence (ritam) generates
pure consciousness and this keeps us free from conditioning and fragmentation.
51. Tasyapi nirhodhe sarva-nirodhan
nirbijah samadhih
Absolute and unconditional freedom without any seed of the mind is the
ending of all endings.
SADHANA PADA
Living practices without longing (sadhana) are the second step
1. Tapah-swadhyaya-ishwara-pranidhanani
kriya-yoga
Kriya Yoga is the perception (pranidhanani)
of the wholeness (ishwara) through
meditation on the ego-mind (swadhyay)
and the burning out of all conditioning (tapah),
using certain practices.
2. Samadhi-bhavana-artha klesha-tanu-karana-arthash
cha
It (kriya yoga) reduces conflict
and develops equanimity in attitude and sentiments (samadhi
bhavana).
3. Avidya-asmita-raga-dwesa-abhiniveshah
kleshah
Indulgence (abhiniveshah) in the
following are the root causes of suffering (kleshah):
1) Incapacity to learn (avidya)
2) I-ness and ego (asmita)
3) Attachments (raga)
4) Aversions (dwesa)
4. Avidya-ksetram-uttaresam prasupta-tanu-vichchino-daranam
The incapacity to learn (avidya)
is the inability to see what is. Avidya can be manifested subtly (tanu)
or appear dormant (prasupta) and
can be scattered unevenly (vichchina)
or ever present (daranam).
5. (I) Anitya-ashuchi-duhkha-anatmasu
nitya-shuchi-sukha-atma-khyatir avidya
Avidya is the non-understanding of what is. Avidya is the
illusion that results in the ephemeral appearing as eternal, of the profane
appearing as sacred, of suffering as pleasure, of self ignorance as self-knowledge.
6. (II) Drig-darshana-shaktyor-eka-atmata-eva-asmita
The dichotomy between the eternal self (atma)
and the ego (asmita) occurs due
to the separation of the observer from the observed (drig-darshana).
7. (III) Sukha-anushayi ragah
Seeking gratification leads to attachment (ragah).
8. (IV) Duhkha-anushayi dwesah
Suffering is a consequence of aversion and hostility (dwesha).
9. (V) Swarasa-vahi vidusoapi tatha
rudho abhinivesa
Indulgence in the continuity of I-ness and ego (swarasa-vahi)
is sustained by conditioning and cultural inputs which dominate even the
learned (vidusoapi).
10. Te pratiprasavah-heyah suksmah
Subtle (psychological) suffering is diminished by inward observation/reflection
(pratiprasavah).
11. Dhyana-heyas tad-vrittayah
The movement of mental suffering can be reduced by meditative awareness.
12. Klesa-mulah karma-ashayo drista-janma-vedaniyah
The root cause of suffering is the reservoir of conditioning (karma)
obviously or unwittingly collected since birth.
13. Sati mule tadvipako jaty-ayur-bhogah
The existence of this root (this reservoir of conditioning) sets off the
whirlpool of lifes trials and tragedies.
14. Te hlada-paritapa-phala punya-apunya-hetutvat
And the result is pleasure and pain, virtue and vice.
15. Parinam-tapa-samskara-duhkhair guna-vritti-virodhch
cha duhkham eva sarvam vivekinah
For one who understands (vivekinah), pleasure and pain are both painful.
They are the consequence of impressions and influences (samskara), of
pain arising from traits, tendencies (gunas), mind (vritti) and the mind's
everlasting indulgence in duality (virodhah) (and opposites) - all leading
to sorrow only.
16. Heyam duhkham anagatam
Sorrow that is yet to come can be reduced or avoided.
17. Drasta-drishyayoh samyogo heya-hetuh
This is possible through a fusion between the observer and the observed.
18. Prakasha-kriya-sthiti-shilam bhutendriya-atmakam
bhoga-aparvargartham drishyam
Pure observation (drishyam) leads
to the emergence of a unitary movement between matter and sense organs
(bhutendriyatmakaram). The purpose
of this is to be liberated from experience (bhoga-aparvarga-artham)
and to be established in the perfect order of enlightened action.
19. Vishesa-avishesa-linga-matra-alingani
guna-parvani
There are four stages of traits and tendencies (gunas),
from profound (vishesha i.e. gunatit),
to not so profound (avishesha i.e. satvic),
to only a trace of profoundness (lingamatra
i.e. rajasic), to none at all (alinga
i.e. tamasic).
20. Drasta drshi-matrah suddhoapi pratyaya-anupashyah
The real observer (no-mind) is only pure observation, without contamination
from the separative observer (mind). Pure observation subtly sees through
direct perception (pratyaya).
21. Tad-artha eva drishyaya-atma
The purpose of pure observation is the dissolution of the separative observer
and the emergence of the eternal observer.
22. Krita-artham prati nastam apyanastam
tad anya-sadharanatvat
A glimpse of the otherness (kritartham)
destroys everything although nothing is destroyed (anya-sadharanatvat)
in relation to all the common cognitive activities.
23. Swa-swami-shaktayoh swa-rupopalabdhi-hetuh
samyogah
The purpose of the fusion of the separative observer (swa)
and the real observer (swami)
is to be in one's natural state (swa-rupopalabdhi).
24. Tasya hetur avidya
This fusion is blocked by a lack of inner awareness (avidya).
25. Tad-abhavat samyoga-abhavo hanam
tad-drishteh kaivalyam
Bondage (hanam) is due to the
absence of this fusion, which in turn is a lack of awareness of the otherness,
whereas a glimpse of the otherness is liberation (kaivalyam).
26. Viveka-khyatir aviplava hanopayah
Discrimination, wakefulness and non-fluctuation are means of avoiding
bondage.
27. Tasya saptadha pranta-bhumih prajna
There are seven stages towards wisdom - intelligence (i.e.
purusha).
28. Yoga-anga-anusthanad ashuddhi-ksaye
jnana-diptir a viveka-kyateh
These are :
1) Living in yoga
2) Ceremony (celebration)
3) Reducing impurity (mental and physical pollution)
4) Subtle knowledge
5) Radiance
6) Discrimination
7) Wakefulness
29. Yama-niyama-asana-pranayama-pratyahara-dharana-dhyana-samdhyo
asta-angani
Eight aspects of yoga life are as follows:
1) Yama: behavioural regulations
2) Niyama: ethical recommendations
3) Asana: posture (sitting in stillness)
4) Pranayama: breath-regulation
5) Pratyahar: detachment
6) Dharana: glimpses of universal intelligence (chaitanya)
7) Dhyana: meditation without mental activity
8) Samadhi: established in equanimity, neither intoxicated nor comatose,
but in a state that is immune from mental problems (samadhan)
30. Ahimsa-satya-asteya-brahmacharya-aparigraha
yamah
Five Yamas:
1) Truthfulness (satya)
2) No over-indulgence or addiction (asteya)
3) No acquisitiveness or stealing (aparigraha)
4) No malice or animosity, i.e. non-violence (ahimsa)
5) No sensual or sexual misconduct (brahmacharya).
31. Jati-desha-kala-samaya-anavachchhinnah
sarva-bhauma mahavratam
Regardless of birth, place or circumstances yamas are important commitments
(mahavratam).
32. Shaucha-santosa-tapah-swadhyaya-iswara-pranidhanani
niyamah
The five niyamas are:
1) Cleanliness (soucha)
2) Contentment (santosha)
3) Restraint or austerity (tapah or dama)
4) Giving up borrowed knowledge in order to be open to knowing
the ego-self (swadhyay or daan)
5) The perception of wholeness or compassion for all (ishwara
pranidhan or daya)
33. Vitarka-badhane pratipaksa-bhavanam
To be trapped in argumentative consciousness generates adversaries and
conflict.
34. Vitarka himsa-adayah krita-karita-anumodita
lobha-krodha-moha-purvaka mridu-madhya-adhimatra duhkha-ajnana-ananta-phala
iti pratipaksa-bhavanam
Whether mild, medium or intense; argument, greed, anger, illusion and
violence (whether approved of, or by oneself, or done through others)
will lead to unlimited sorrow, ignorance and hostility.
35. Ahimsa-pratisthayam tat-sanidhau
vaira-tyagah
There is a cessation of hostility in the vicinity of one who is installed
in non-violence.
36. Satya-pratisthayam kriya-phala-ashrayatvam
The consequence of actions by one who is established in truthfulness forms
a good basis for right living.
37. Asteya-pratisthayam sarva-ratno-pasthanam
All the gems of living are available to those who are installed in non-addiction.
38. Bramacharya-pratisthayam virya-labhah
Indomitable energy is gained when one is established in sky-consciousness
(bramacharya).
39. Aparigraha-sthairye janma-kathanta
sambodhah
One who is steady in non-acquisitiveness is available to the supreme wisdom
that leads to the perception of the wonders of birth and death.
40. Shauchat swa-anga-jugupsa parair
samsargah
Cleanliness in all ways leads to freedom from body-consciousness and attachment
to other bodies.
41. Sattva-shuddhi-saumanasya-ekaagrya-indriya-jaya-atma-darshana-yogyatvani
cha
Through pure being (rather than becoming) emerges equanimity, freedom
from distractions and sensuality, and glimpses of the eternal self.
42. Santosad anuttamah sukha-labhah
Contentment (non-craving) gives rise to supreme happiness.
43. Kaya-indriya-siddhir ashuddhi-ksayat
tapasah
Living with austerity and restraint causes the disappearance of disharmony
in the structure of body-mind and the emergence of perfection.
44. Swadhyayad ista-devata-samprayogah
Meditation on the nature of the ego-self causes its melting into benediction
and sanctity.
45. Samadhi-siddhir ishwara-pranidhanat
Being established in equanimity is perfection Then holistic perception
begins.
46. Sthira-sukham asanam
Stillness and steadiness are only possible when ones posture is
comfortable.
47. Prayatna-shaithilya-ananta-samapattibhyam
Eternal freedom (ananta) is the
release (shaithilya) from expectations
and effort (prayatna). This means
being equally indifferent.
48. Tato dvandva-anabhighatah
Then conflict and agitation can have no impact.
49. Tasmin sati shvasa-prashvasayor
gati-vichchhedah pranayamah
Then consolidate this freedom from mind by practising pranayam. This is
inhalation and exhalation with an intervening pause (an internalisation
process).
50. Bahya-abhyantara-stambha-vrittir
desha-kala-sankhyabhih paridristo dirgha-suksmah
The health and age of the body determine the duration, subtlety and frequency
of pranayam. Pranayam can be classified as follows:
Internal (as indicated above)
External (anulom-vilom-vastrika)
Retention (stambha or kumbhaka)
Or, it may happen in rounds (vrittih)
of inhalation, retention and exhalation.
51. Bahya-abhyantara-visaya-aksepi chaturthah
Another kind of pranayam concerns watching outer influences and inner
conditioned reflexes in rhythm with the breath and thus transcending such
influences and reflexes (this is called adjapajap
or anapanasati).
52. Tatah ksiyate prakasa-avaranam
Thereby that which covers the light starts disappearing (this is meditation
dhyana that removes
the cover of borrowed knowledge and ushers us into the light of our own
knowing).
53. Dharanasu cha yogyata manasah
The separative consciousness is then eligible to be available to that
which holds all life.
54. Swa-visaya-asamprayoge chittasya
swa-rupa-anukara iva indriyanam pratyaharah
Detachment (pratyahar) implies
avoiding involvement in selfishness (swavisaya
asamprayoge) and sensual (indriyanam)
indulgences (anukarah) of the
mind.
55. Tatah parama vashyate indriyanam
Thereafter occurs the supreme mastery over sensuality (mind).
VIBHUTI PADA
Reducing mind into ashes is the third
step
[The ashes are the vibhuti of Shiva. By mind is meant craving, fear and
dependency, not memory and intellect.]
1. Desa-bandhas chittasya dharana
Pauses and spaces in the movement of the mind is that which holds life.
2. Tatra pratyayi-'katanata dhyanam
In such pauses is the uninterrupted perception of what is. This is meditative
insight.
3. Tad eva-artha-matra-nirbhasam swarupa-sunyamiva
samadhih
With meditative insight the natural state appears as emptiness. And this
is Samadhi.
4. Trayam ekatra samyamah
Dharana, Dhyana, Samadhi this trinity constitutes perfect order
(samyama).
5. Taj jayat prajna alokah
From that emerges enlightenment.
6. Tasya bhumisu viniyogah
Enlightenment transforms the basis of the separative consciousness.
7. Trayam-antar-angam purvebhyah
This trinity is inward-orientated in comparison with the previous ones
(yama, niyama, asana, pranayama, and
pratihar).
8. Tad api bahir-angam nirbijasya
Even this trinity can be regarded as centrifugal in relation to absolute
freedom without any seed of the mind (neerbija
samadhi).
9. Vyutthana-nirodha-samskarayor abhirbhava-pradurbhavau
nirodha-ksana-chitta-anvayo nirodha-parinamah
The occurrence, appearance and disappearance of conditioning should also
become discontinuous along with breaks in the constant churning of thought.
This will be considered as the complete consolidation of discontinuity
(nirodha parinamah).
10. Tasya prasanta vahita samskarat
Benediction flows therefrom in spite of all conditioning.
11. Sarva-arthatai-'kagratayoh ksayo
'dayam chittasya samadhi-parinamah
The consolidation of equanimity (samadhi
parinamah) is possible through unwavering holistic attention (choiceless
wakefulness) in spite of mind's waxing and waning (kshyodayam).
12. Tatah punah shanto 'ditau tulya-pratyayau
chittasyai 'kagrata-parinamah
Following the consolidation of equanimity the consolidation of an unwavering
attention (ekagrata-parinamah)
is possible through non-dualistic perception (tulya
pratyayau) in sleep and while awake (shantoditau).
13. Etena bhute-indriyesu dharma-laksana-avastha-parinama
vya khyatah
Thus is explained the consolidation of natural state (dharma),
and the transformation of both mental and physical characteristics (laxana)
and conditioning (avastha or bhutendriya).
14. Shanto-'dita-avyapadeshya-dharma-anupati-dharmi
Whether latent and peaceful (shanta),
manifest (udita) or unmanifest
(avyapadesha) there is accordance
in their properties, they share a common ground (dharmi).
15. Krama-ayatvam parinama-anyatve hetuh
Different sequence of Gunas (Krama)
cause various consolidations (parinamah).
16. Parinama-traya-samyamad atita-anagata-jnanam
From the perfect order of the trinity (nirodha,
samadhi, ekagrata) arises knowing of the past and the future (atitanagata).
Mind is past and future. Life is presence.
17. Shabda-artha-pratyayanam itare-itara
adhyasat samskaras tat pravibhaga-samyamat sarva- bhuta-ruta-jnanam
Imposing (adhyasat) pre-formed
concepts (itara) on words and
understanding of their meanings (shabdartha-pratyayanam) creates confusion
(samkar). If this is restrained,
it is possible to communicate with all beings.
18. Samskara-saksat karanat purva-jati-jnanam
By watching conditioning, it is possible to trace its origins.
19. Pratyasya para-chitta-jnanam
By direct perception, it is possible to know others' motives.
20. Na cha tat sa-lambanam tasya avisayi
bhutatvat
But this is not based on any mental images about others.
21. Kaya-rupasamyamat tad grahya-shakti-stambhe
chaksuh prakasha-asamyoge antardhanam
By restraining our absorption with the body, by suspending unnecessary
concerns about it, and by refusing to notice all its goings-on, it is
possible to be free from body-infatuation.
22. Etena shabdady antardhanam uktam.
In this manner the verbalizations and patterns of experience that arise
from body-infatuation disappear. This reveals tanmatras - the ability
to directly perceive through the senses without converting these perceptions
into sensuality.
23. Sopakranam nirupakramam cha karman
tat samyamad aparanta-jnanam aristebhyo va
By restraining involvement in [mental] activities, and also by not getting
involved in them when they occur, it is possible to know their outcome
(aparanta), whether good or bad.
24. Maitriyadisu balani
Friendliness generates strength.
25. Balesu hasti-bala-adini
Imagining an elephant's strength makes one feel strong.
26. Pravrtti-aloka-nyasat suksma-vyavahita-viprakrista-jnanam
It is possible to develop [x-ray-like and telescopic] vision that enables
one to know about hidden and distant objects.
27. Bhuvana-jnanam surye samyamat
Knowledge of astronomy is possible through meditation on the sun.
28. Chandre tara-vyuha -jnanam
Knowledge about clusters of stars is possible through meditation on the
moon.
29. Dhruve tad gati-jnanam
Knowledge about the movement of stars is possible through meditation on
the pole-star.
30. Nabhi-chakre kaya-vyuha-jnanam
Meditation on the navel reveals a phenomenon that dispels fear and brings
wisdom.
31. Kantha-kupe ksut-pipasa-nivrittih
Meditation on the vishuddha (the pit of the throat) reduces hunger and
thirst.
32. Kurma-nadyam sthairyam
Steadiness comes through Jalandhar Bandh (Kurma-nadi).
[Jalandhar Bandh is pressing the
chin on the chest]
33. Murdha-jyotisi siddha-darshanam
Meditation on the crown chakra reveals the light of authentic vision.
34. Pratibhad va sarvam
Or a wholeness through radiance.
35. Hrdaye chitta-samvit
The ways of the mind are fully understood through perception by the heart.
36. Sattva-purusayor atyanta-asamkirnayoh
pratyaya-avisheso bhogah para-arthatvat swa- artha-samyamat purusa-jnanam
Divine intelligence (purusha)
is infinite (atyanta-asankirnayoh).
Vague (avishesha) perception (pratyay)
of this intelligence is experience (bhogah).
When there is movement from centrifugal awareness (pararthatwa)
to a centripetal knowing process (swa-artha-samyama)
then the wisdom of this intelligence (purusha-jnanam)
will flow.
37. Tatah pratibha-shravana-vedana-adarsha-asvada-varta
jayante
This (wisdom) produces (jayanta)
a faculty of holistic consciousness (prathiba)
that directly perceives at the level of the ears (shravana),
touch (vedana), eyes (adarsha),
taste (asvada) and smell (varta).
And thus teaching by the divine intelligence (purusha)
may now be possible.
38. Te samadhav upasargah vyutthane
siddhayah
A symptom of the energy of equanimity (samadhav
upasargah) can emerge (vyutthane)
as erratic powers (siddhis). [But
the ending of such powers i.e. siddhanta is the most profound principle].
39. Bandha-karana-shaithilyat prachara-samvedanach
cha chittasya para-sharira-avesah
Bondage-less-ness and causeless-ness spread and expand (prachar)
sensitivity. This purified consciousness can influence other bodies (parashariravesha).
40. Udana-jayaj jala-panka-kantaka-adishv
asanga ukrantish cha
It is possible to uplift oneself from natural adversities by transcending
certain basic vibrations of life.
41. Samana-jayaj jvalanam
The body may blaze through some other vibrations.
42. Shrotra-akashayoh sambandha-samyamad
divyam srotram
A harmony (sanyama) in the connection
(sambandha) between listening
and emptiness (shrotraakashayoh)
leads to hearing the cosmic intelligence (divyam).
43. Kaya-akashayoh sambandha-samyamal
laghu-tula-samapattesh cha akasha-gamanam
A harmony in the connection between the body and nature through equal
[choiceless] aloofness makes one feel light (laghu)
as if floating in space.
44. Bahir akalpita vrittir maha-videha
tatah prakasha-avarana-ksayah
In the supreme state of existence (maha
videha) the burden and bondage of experience is absent, and the
indulgence of the mind (vrittih)
in the external is ceased. This destroys the covering that obscures us
from enlightenment (prakash-àvarana-ksayah).
45. Sthula-swarupa-suksma-anvaya-arthavattva-samyamad
bhuta-jayah
By using restraint (samjayamat)
to bring harmony (anvaya arthavattva)
between "what should be" (sthula),
"what is" (swarupa)
and ones most subtle motives (suksma),
it is possible to overcome the past [i.e. mind, conditioning and karmic
effect].
46. Tato animadi pradur bhavah kaya
sampat tad dharma anaabhighatash cha
From freedom from the past emerges much bliss and benediction (animadi-pràdurbhàva).
Then the body is in the natural state, it is in a state of well-being
(kaya sampat tad dharma) and obstructions
to the process of freedom also cease (ana-abhighata).
47. Rupa-lavanya-bala-vajra-samhananatvanikaya-sampat
The treasures of the body (kaya-sampat)
are beauty (rupa), grace (lavanya),
energy (bala), and strength (vajra-samhananatwani).
48. Grahana-swarupa-ashmita-anvaya-arthavattva-samyamad
indriya-jaya
Availability (grahana) to the
natural state (swarupa) occurs
through understanding the ego-self (asmita).
This leads to the overcoming of sensuality (indriya)
[by not converting sensory perceptions (life) into sensuality (mind)].
49. Tato mano-javitvam vikarana-bhavah
pradhana-jayash cha
Freedom from the sense-organs (vikarana
bhava) and from domination by the mind (manojawitwam)
is the greatest victory (Pradhanajayash).
50. Sattva-purusa-anyata-khyati-matrasya
sarva-bhava-adhistha-tritvam sarva-jnatritvam cha
The very awareness (khyati matrasya)
of the difference (anyata) between
intelligence (purusha) and intellect
(sattwa) can establish (adhistha-tritvam)
an all-pervading state of existence (sarvabhava)
and all-encompassing wisdom (sarvajnatritvam).
51. Tad-vairagyad api dosa-bija-ksaye
kaivalyam
When one remains disinterested in such achievements (tat-vairagyat-api),
a state of aloofness (khaivalyam)
is possible through the destruction of the seeds of malice (dosa
beeja kshyaye).
52. Sthany-upanimantrane asanga-smaya-akaranam
punar anista-prasangat
A Yogi is respectfully invited to many places (sthani-upanimantrane),
but a Yogi does not get into (akaranam)
any attachment (sanga) or pride
(asmaya) as this may once again
(punah) establish a harmful situation
(anista-prasangat).
53. Ksana-tat-kramayoh samyamad viveka-jam
jnanam
By careful and conscientious awareness (samyamat-vivekajam)
from moment to moment (Ksana-tat-kramayoh)
it is possible to be available to the perception of reality [not experience].
54. Jati-laksana-deshair anyata anavachchhedat
tulyayos tatah pratipattih
One becomes respected and reputed when one treats all equally (tulyayoh),
without discrimination (an-avachchhedàt)
despite differences (anyatà)
in birth (jati), characteristics
(laxana) or origins (deshaih).
55. Tarakam sarva-visayam sarvatha visayam
akramam cha iti viveka-jam-jnanam
Knowing is only possible by a direct perception (vivekajam)
that transcends (tarakam) everything
(sarva visayam), every place (sarvatha),
and is beyond all disorders (akramam).
56. Sattva-purusayoh shuddhi-sumye kaivalyam-iti
Pure harmony (shuddhisamye) between
intellect (sattwa - ego-self)
and intelligence (purusha) is
the state of kaivalya [absolute aloneness, not loneliness nor isolation,
but total freedom].
KAIVALYA PADA
Aloneness is the fourth and the final step
1.Janmau-sadhi-mantra-tapah-samadhi-jah
siddayah
Perfection and excellence (Siddhayah)
are the outcome of birth, herbs, sacred sounds, burning mental conditioning
and finally equanimity (samadhi).
2.Jati-antara-parinamah prakritya-apurat
It is the overflowing grace of nature (Prakriti-apurat)
that results in the transformation of one trait (guna)
to the other (jati-antara).
3.Nimittam aprayojakam prakritinam varana-bhedas
tu tatah ksetrikavat
Like a farmer (Ksetrikavat) who
merely removes obstacles (varana-bheda)
to natural growth; although ones activities may seem important (nimittam),
they are not really necessary (aprayojakam)
for the traits (gunas) or nature
(prakriti) to perform eventually.
4.Nirmana-chittani asmita-matrat
All the concoctions of the mind are just aspects of ego (asmita-matra).
5.Pravritti-bhede prayojakam chittam
ekam anekesam
It is different conditioned responses (pravritti-bhede)
that produce the various fragmentations of the mind (chittam-ekam-anekesam).
6.Tatra dhyana-jam anashaya
Freedom from accumulation (anashayam)
is the beginning of meditation (dhyanajam).
7.Karma-ashukla-akrisnam yoginas trividham
itaresam
The actions of yogis are neither good nor bad because they are free from
opposites [as a result of direct perception], whereas the activities of
others are of three kinds - good, bad and mixed [as a result of concepts
and conditioning].
8.Tatas tad-vipaka-anugunanam eva vasananam
Cravings and desires requiring fulfillment manifest themselves in accordance
with the turbulence of ones traits and tendencies (gunas).
[This turbulence or immense intensification is the I-ness].
9.Jati-desha-kala-vyavahitanam apy anantaryam
smrti-samskararayor eka rupatvat
The structure of experience and conditioning is similar in all humanity
despite differences of birth, place and time. The existential eternity
is outside this structure
10.Tasam anaditvam cha ashiso nityatvat
Existential eternity is beginninglessness (anaditwam),
benediction (ashisah) and endlessness
(nityatvat).
11.Hetu-phala-ashraya-alambanaih samgrihitatvad
esam abhave tad abhavah
The absence of accumulated habitual reactions (hetu-phala)
in which a cause always leads to a particular effect (ashraya-alambanaih),
results in freedom from the structure of experience and conditioning (tat-abhavah).
12.Atita-anagatam svarupato asty adhva-bhedad
dharmanam
In the natural state, beyond past and future [the domains of the mind],
one is available to a penetrating insight into that which holds life (adhwabhedad
dharmanam).
13.Te vyakta-sukshmah gunaatmana
And thus the subtle aspects of the minds conditioning are revealed.
14.Parinamai-ekatvad vastu-tattvam
The consequence (parinam) of these
revelations is non-duality and that is the existential reality (vastu-tatvam).
15.Vastu-samye chitta-bhedat tayor vibhaktah
panthah
Harmony with existential reality then manifests (panthah)
by transcending all the differences, dualities and divisions of the separative
consciousness (chittabhedat-tayor vibhaktah).
16.Na cha eka-chitta-tantram vastu tad-apramanakam
tada kim syat
Existential reality is not concerned with the matters of the separative
consciousness (na cha eka chitta tantram
vastu). What would happen if (tada
kim syat) cognition by the separative consciousness (chitta)
did not take place (tat-apramanakam)?
17.Tad-uparaga-apeksitvat chittasya
vastu jnata-ajnatam
Existential reality remains known and unknown (vastu
jnata-ajnatam) depending on ones degree of involvement in
the minds mechanisms (tat-uparaga-apeksitvat
chittasya).
18.Sada jnanatah chitta-vrittayas tat-prabhoh
purusasya aparinamitvat
Cosmic intelligence is consequence-less, change-less, choice-less and
eternal (purusasya aparinamitvat).
Only it can always see (sada jnatah)
the protective mechanisms of the mind and ego (chitta-vrittayah)
and can supercede them (tat-prabhoh).
[That is, can set us free from mind-ego in spite of it remaining available
for practical functioning].
19.Na tat svaabhasam drishyatvat
This (chitta - separative consciousness)
cannot observe itself, nor can it understand itself (svaabhasam).
20.Eka-samaye cho bhaya-anavadharanam
Cosmic intelligence and ego-mind (ubhaya)
cannot be held (anavadharanam)
simultaneously (eka-samaye).
21.Chitta-anantaradrishye buddhi-buddher
atiprasangah smrti-samskarah cha
Disorders in the field of memory and in the structure of experience (smrti-samskarah
cha) occur when perception (buddhi-buddheh)
is confused (atiprasangah) by
mental images and investments (chitta-anantaradrishye).
22.Chitter apratisamkramayas tad-akara-apattau
svabuddhi-samvedana
When the mind ceases to contaminate perception (chitteh-aprati
samkramaya), then what is (tat-akara)
arises (apattau). This leads to
perception (samvedanam) and insight
(swa-buddhi).
23.Drastri-drishyya-aparaktam chittam
sarva-artham
To transcend beyond (aparaktam)
minds division between the observer and the observed (drastri-drishyya)
reveals the wonder of all existence (sarvartham).
24.Tad-asamkhyeya-vasanabhish-chitram
api para-artham samhatya kariyvat
Then harmoniousness (samhatyakariyvat)
with the otherness (Paratham)
is possible despite (api) the
continued existence of innumerable (asamkhyeya)
images (chitram) produced by motives
(vasanas).
25.Vishesa-darshina atma-bhava-bhavana-vinivrittih
When the total annihilation of the feeling of I-ness takes place (atma-bhava-bhavana-vinivrittih),
an indefinable yet immanent seeing (vishesa-darshinah)
is possible.
26.Tada hi vivekanimnam kaivalya-pragbharam
chittam
Then separative consciousness (chittam)
becomes inclined to a profound conscience (vivekanimnam)
and is thus tilted towards aloneness (kaivalya-pragbharam).
27.Tad-chidresu pratyaya-antarani samskarebhyah
Holes in this conscience (tad-chidresu)
may still appear because of conditioning (samskarebhyah),
other feelings and emotions (pratyayantarani).
28.Hanam esam kleshavad ukta
Negating (hanam) such (esam)
conditioning is said to (uktam)
remove many kinds of suffering (kleshavad).
29.Prasamkhyanepi akusidasya sarvatha
viveka-khyater dharma-megha samadhih
In equanimity (samadhi) there
is an increasing intensification (megha)
of the natural state of being (dharma).
The climax of a conscientuous consciousness (viveka-khyateh)
is always (sarvatha) a state of
tranquil wakefulness. And this happens when there are no aspirations whatsoever,
even (api) for samkhya knowledge,
that is, when one is totally disinterested (akusidasya)
in all pursuits.
30.Tath klesha-karma-nivrittih
Thereafter arises freedom from affliction and suffering (klesha)
and from the cycle of cause and effect (karma).
31.Tada sarva-avarana-mala-apetasya
jnanasya anantyat jneyam alpam
Then by the denial (apetasya)
of all veils and impurities (sarva-avarana-mala),
wisdom becomes infinite (jnanasya anantyat)
and hardly anything is left to be curious about (jneya).
32.Tatah krita-arthanam parinama-krama-samaptir
gunanam
Thereafter, for the blessed ones (kritarthanam),
the consequences (parinama) of
the phenomenon (krama) of conditioned
reflexes disappear (Samaptih).
An absolute freedom indeed.
33. Ksana-pratiyogi parinama-aparanta-nirgrahyah
kramah
The veracity of the phenomenal consequences of conditioned mind is to
be perceived (nirgrahyah) from
moment to moment (ksana-pratiyogi).
34.Purusha-artha-shunyanam gunanam pratiprasavah
kaivalyam svarupa-pratistha va chiti-shakter iti
The elimination of the entity appearing as self (purusa-artha)
leads to involution and the absorption (pratiprasavah)
of all conditioning (gunanam).
This consolidates the natural state and gives rise to total aloneness
(kaivalyam svarupa-pratistha).
Now one is wholly available to cosmic intelligence (chiti)
and energy (shakti). Now silence
(iti).